KLC2 (NM_022822) Human Mass Spec Standard

SKU
PH314206
KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_073733)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214206]
Predicted MW 68.8 kDa
Protein Sequence
Protein Sequence
>RC214206 representing NM_022822
Red=Cloning site Green=Tags(s)

MAMMVFPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEAIEL
GLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFM
SQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSPGGGDVSGQHGGYEIPARLRTLHNLVIQYAS
QGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPA
VAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRA
LEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREE
SKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRNRKQGLDPASQTK
VVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNGDGSGSLRRSGSFGKLRDALRRSSEML
VKKLQGGTPQEPPNPRMKRASSLNFLNKSVEEPTQPGGTGLSDSRTLSSSSMDLSRRSSLVG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_073733
RefSeq Size 2992
RefSeq ORF 1866
Locus ID 64837
UniProt ID Q9H0B6
Cytogenetics 11q13.2
Summary The protein encoded by this gene is a light chain of kinesin, a molecular motor responsible for moving vesicles and organelles along microtubules. Defects in this gene are a cause of spastic paraplegia, optic atrophy, and neuropathy (SPOAN) syndrome. [provided by RefSeq, Mar 2016]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:KLC2 (NM_022822) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH326034 KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_001128247) 10 ug
$3,255.00
PH326035 KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_001128248) 10 ug
$3,255.00
LC402950 KLC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427490 KLC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427491 KLC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427492 KLC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402950 Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 1 100 ug
$436.00
LY427490 Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 2 100 ug
$436.00
LY427491 Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 3 100 ug
$436.00
LY427492 Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 4 100 ug
$436.00
TP314206 Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 1, 20 µg 20 ug
$737.00
TP326034 Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 3, 20 µg 20 ug
$737.00
TP326035 Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 4, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.