ACSM2B (NM_001105069) Human Recombinant Protein
SKU
TP325976
Recombinant protein of human acyl-CoA synthetase medium-chain family member 2B (ACSM2B), transcript variant 2, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC225976 representing NM_001105069
Red=Cloning site Green=Tags(s) MHWLRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWADMEKAGKRLPSPALW WVNGKGKELMWNFRELSENSQQAANILSGACGLQRGDRVAVMLPRVPEWWLVILGCIRAGLIFMPGTIQM KSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVSEKSCDGWLNFKKLLNEASTTHHCVET GSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWTGLQASDIMWTISDTGWILNILGSLLESWTLG ACTFVHLLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQQDLSSYKFPHLQNCLAGGESLLPETLENWR AQTGLDIREFYGQTETGLTCMVSKTMKIKPGYMGTAASCYDVQVIDDKGNVLPPGTEGDIGIRVKPIRPI GIFSGYVENPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADDIINSSGYRIGPSEVENALMKHPAVVE TAVISSPDPVRGEVVKAFVILASQFLSHDPEQLTKELQQHVKSVTAPYKYPRKIEFVLNLPKTVTGKIQR TKLRDKEWKMSGKARAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 64.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001098539 |
Locus ID | 348158 |
UniProt ID | Q68CK6 |
Cytogenetics | 16p12.3 |
RefSeq ORF | 1731 |
Synonyms | ACSM2; HXMA; HYST1046 |
Summary | Has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). Acts on acids from C(4) to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH314283 | ACSM2B MS Standard C13 and N15-labeled recombinant protein (NP_872423) | 10 ug |
$3,255.00
|
|
PH325976 | ACSM2B MS Standard C13 and N15-labeled recombinant protein (NP_001098539) | 10 ug |
$3,255.00
|
|
LC405460 | ACSM2B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC426214 | ACSM2B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY405460 | Transient overexpression lysate of acyl-CoA synthetase medium-chain family member 2B (ACSM2B), nuclear gene encoding mitochondrial protein, transcript variant 1 | 100 ug |
$665.00
|
|
LY426214 | Transient overexpression lysate of acyl-CoA synthetase medium-chain family member 2B (ACSM2B), transcript variant 2 | 100 ug |
$436.00
|
|
TP314283 | Recombinant protein of human acyl-CoA synthetase medium-chain family member 2B (ACSM2B), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.