ACSM2B (NM_001105069) Human Mass Spec Standard

SKU
PH325976
ACSM2B MS Standard C13 and N15-labeled recombinant protein (NP_001098539)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225976]
Predicted MW 64.1 kDa
Protein Sequence
Protein Sequence
>RC225976 representing NM_001105069
Red=Cloning site Green=Tags(s)

MHWLRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWADMEKAGKRLPSPALW
WVNGKGKELMWNFRELSENSQQAANILSGACGLQRGDRVAVMLPRVPEWWLVILGCIRAGLIFMPGTIQM
KSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVSEKSCDGWLNFKKLLNEASTTHHCVET
GSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWTGLQASDIMWTISDTGWILNILGSLLESWTLG
ACTFVHLLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQQDLSSYKFPHLQNCLAGGESLLPETLENWR
AQTGLDIREFYGQTETGLTCMVSKTMKIKPGYMGTAASCYDVQVIDDKGNVLPPGTEGDIGIRVKPIRPI
GIFSGYVENPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADDIINSSGYRIGPSEVENALMKHPAVVE
TAVISSPDPVRGEVVKAFVILASQFLSHDPEQLTKELQQHVKSVTAPYKYPRKIEFVLNLPKTVTGKIQR
TKLRDKEWKMSGKARAQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001098539
RefSeq ORF 1731
Synonyms ACSM2; HXMA; HYST1046
Locus ID 348158
UniProt ID Q68CK6
Cytogenetics 16p12.3
Summary Has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). Acts on acids from C(4) to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ACSM2B (NM_001105069) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH314283 ACSM2B MS Standard C13 and N15-labeled recombinant protein (NP_872423) 10 ug
$3,255.00
LC405460 ACSM2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426214 ACSM2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405460 Transient overexpression lysate of acyl-CoA synthetase medium-chain family member 2B (ACSM2B), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$665.00
LY426214 Transient overexpression lysate of acyl-CoA synthetase medium-chain family member 2B (ACSM2B), transcript variant 2 100 ug
$436.00
TP314283 Recombinant protein of human acyl-CoA synthetase medium-chain family member 2B (ACSM2B), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg 20 ug
$737.00
TP325976 Recombinant protein of human acyl-CoA synthetase medium-chain family member 2B (ACSM2B), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.