RIPX (RUFY3) (NM_001130709) Human Recombinant Protein

SKU
TP325870
Recombinant protein of human RUN and FYVE domain containing 3 (RUFY3), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225870 representing NM_001130709
Red=Cloning site Green=Tags(s)

MAETPPPPTAGAESCSEEPARGGEWRPEEPRRAPAGGTDREGEAGPPPASPAGQSEPDSPVAAPFFLLYP
GDGGAGFGVRPPPQQQRSWRTPPSPGSPLPFLLLSYPSGGGGSSGSGKHHPNYLMANERMNLMNMAKLSI
KGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASV
KDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEPNALMMEEEGAIIAGLLVGLNVIDA
NFCMKGEDLDSQVGVIDFSMYLKDGNSSKGTEGDGQITAILDQKNYVEELNRHLNATVNNLQAKVDALEK
SNTKLTEELAVANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQALSEARKHLKEETQLRLDVE
KELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVKQKSELNSRLE
EKTNQMAATIKQLEQR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001124181
Locus ID 22902
UniProt ID Q7L099
Cytogenetics 4q13.3
RefSeq ORF 1518
Synonyms RIPX; SINGAR1; ZFYVE30
Summary This gene encodes a RPIP8, UNC-14, and NESCA domain-containing protein that is required for maintenance of neuronal polarity. In addition, it has been implicated in mediation of gastric cancer cell migration and invasion via interaction with P21-activated kinase-1, which promotes its expression. The encoded protein localizes to F-actin-enriched invadopodia to induce formation of protrusions, thereby facilitating cell migration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016]
Write Your Own Review
You're reviewing:RIPX (RUFY3) (NM_001130709) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307961 RUFY3 MS Standard C13 and N15-labeled recombinant protein (NP_055776) 10 ug
$3,255.00
PH325870 RUFY3 MS Standard C13 and N15-labeled recombinant protein (NP_001124181) 10 ug
$3,255.00
LC414890 RUFY3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427257 RUFY3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414890 Transient overexpression lysate of RUN and FYVE domain containing 3 (RUFY3), transcript variant 2 100 ug
$436.00
LY427257 Transient overexpression lysate of RUN and FYVE domain containing 3 (RUFY3), transcript variant 3 100 ug
$436.00
TP307961 Recombinant protein of human RUN and FYVE domain containing 3 (RUFY3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.