RIPX (RUFY3) (NM_014961) Human Mass Spec Standard

SKU
PH307961
RUFY3 MS Standard C13 and N15-labeled recombinant protein (NP_055776)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207961]
Predicted MW 53 kDa
Protein Sequence
Protein Sequence
>RC207961 protein sequence
Red=Cloning site Green=Tags(s)

MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLMANERM
NLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLV
PEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEPNALMMEEEGAIIAG
LLVGLNVIDANFCMKGEDLDSQVGVIDFSMYLKDGNSSKGTEGDGQITAILDQKNYVEELNRHLNATVNN
LQAKVDALEKSNTKLTEELAVANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQALSEARKHLK
EETQLRLDVEKELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVK
QKSELNSRLEEKTNQMAATIKQLEQSEKDLVKQAKTLNSAANKLIPKHH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055776
RefSeq Size 4419
RefSeq ORF 1407
Synonyms RIPX; SINGAR1; ZFYVE30
Locus ID 22902
UniProt ID Q7L099
Cytogenetics 4q13.3
Summary This gene encodes a RPIP8, UNC-14, and NESCA domain-containing protein that is required for maintenance of neuronal polarity. In addition, it has been implicated in mediation of gastric cancer cell migration and invasion via interaction with P21-activated kinase-1, which promotes its expression. The encoded protein localizes to F-actin-enriched invadopodia to induce formation of protrusions, thereby facilitating cell migration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016]
Write Your Own Review
You're reviewing:RIPX (RUFY3) (NM_014961) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH325870 RUFY3 MS Standard C13 and N15-labeled recombinant protein (NP_001124181) 10 ug
$3,255.00
LC414890 RUFY3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427257 RUFY3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414890 Transient overexpression lysate of RUN and FYVE domain containing 3 (RUFY3), transcript variant 2 100 ug
$436.00
LY427257 Transient overexpression lysate of RUN and FYVE domain containing 3 (RUFY3), transcript variant 3 100 ug
$436.00
TP307961 Recombinant protein of human RUN and FYVE domain containing 3 (RUFY3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325870 Recombinant protein of human RUN and FYVE domain containing 3 (RUFY3), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.