CCBL1 (KYAT1) (NM_001122671) Human Recombinant Protein
SKU
TP325677
Recombinant protein of human cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 2, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC225677 representing NM_001122671
Red=Cloning site Green=Tags(s) MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYP PLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPV FVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVC ITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHC PTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRK MPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV EL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001116143 |
Locus ID | 883 |
UniProt ID | Q16773 |
Cytogenetics | 9q34.11 |
RefSeq ORF | 1266 |
Synonyms | CCBL1; GTK; KAT1; KATI |
Summary | This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH316317 | CCBL1 MS Standard C13 and N15-labeled recombinant protein (NP_004050) | 10 ug |
$3,255.00
|
|
PH325677 | CCBL1 MS Standard C13 and N15-labeled recombinant protein (NP_001116143) | 10 ug |
$3,255.00
|
|
LC401315 | CCBL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC426545 | CCBL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401315 | Transient overexpression lysate of cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 1 | 100 ug |
$665.00
|
|
LY426545 | Transient overexpression lysate of cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 2 | 100 ug |
$436.00
|
|
TP316317 | Recombinant protein of human cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.