CCBL1 (KYAT1) (NM_001122671) Human Mass Spec Standard

SKU
PH325677
CCBL1 MS Standard C13 and N15-labeled recombinant protein (NP_001116143)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225677]
Predicted MW 47.7 kDa
Protein Sequence
Protein Sequence
>RC225677 representing NM_001122671
Red=Cloning site Green=Tags(s)

MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYP
PLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPV
FVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVC
ITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHC
PTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRK
MPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV
EL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001116143
RefSeq ORF 1266
Synonyms CCBL1; GTK; KAT1; KATI
Locus ID 883
UniProt ID Q16773
Cytogenetics 9q34.11
Summary This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CCBL1 (KYAT1) (NM_001122671) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316317 CCBL1 MS Standard C13 and N15-labeled recombinant protein (NP_004050) 10 ug
$3,255.00
LC401315 CCBL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426545 CCBL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401315 Transient overexpression lysate of cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 1 100 ug
$665.00
LY426545 Transient overexpression lysate of cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 2 100 ug
$436.00
TP316317 Recombinant protein of human cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 1, 20 µg 20 ug
$737.00
TP325677 Recombinant protein of human cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.