LCE6A (NM_001128600) Human Recombinant Protein

SKU
TP324998
Recombinant protein of human late cornified envelope 6A (LCE6A), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224998 representing NM_001128600
Red=Cloning site Green=Tags(s)

MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTY
HCKEEECEGD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 8.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001122072
Locus ID 448835
UniProt ID A0A183
Cytogenetics 1q21.3
RefSeq ORF 240
Synonyms C1orf44
Summary Precursors of the cornified envelope of the stratum corneum.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:LCE6A (NM_001128600) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH324998 LCE6A MS Standard C13 and N15-labeled recombinant protein (NP_001122072) 10 ug
$3,255.00
LC426969 LCE6A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY426969 Transient overexpression lysate of late cornified envelope 6A (LCE6A) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.