Myosin (MYL6) (NM_079423) Human Recombinant Protein

SKU
TP324925
Recombinant protein of human myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224925 protein sequence
Red=Cloning site Green=Tags(s)

MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHF
LPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCIN
YEELVRMVLNG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_524147
Locus ID 4637
UniProt ID P60660
Cytogenetics 12q13.2
RefSeq Size 782
RefSeq ORF 453
Synonyms ESMLC; LC17; LC17-GI; LC17-NM; LC17A; LC17B; MLC-3; MLC1SM; MLC3NM; MLC3SM
Summary Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Vascular smooth muscle contraction
Write Your Own Review
You're reviewing:Myosin (MYL6) (NM_079423) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300708 MYL6 MS Standard C13 and N15-labeled recombinant protein (NP_066299) 10 ug
$3,255.00
PH324925 MYL6 MS Standard C13 and N15-labeled recombinant protein (NP_524147) 10 ug
$3,255.00
LC409203 MYL6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412144 MYL6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409203 Transient overexpression lysate of myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 2 100 ug
$436.00
LY412144 Transient overexpression lysate of myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 1 100 ug
$436.00
TP300708 Recombinant protein of human myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.