Myosin (MYL6) (NM_079423) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC224925] |
Predicted MW | 17 kDa |
Protein Sequence |
Protein Sequence
>RC224925 protein sequence
Red=Cloning site Green=Tags(s) MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHF LPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCIN YEELVRMVLNG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_524147 |
RefSeq Size | 782 |
RefSeq ORF | 453 |
Synonyms | ESMLC; LC17; LC17-GI; LC17-NM; LC17A; LC17B; MLC-3; MLC1SM; MLC3NM; MLC3SM |
Locus ID | 4637 |
UniProt ID | P60660 |
Cytogenetics | 12q13.2 |
Summary | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Vascular smooth muscle contraction |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300708 | MYL6 MS Standard C13 and N15-labeled recombinant protein (NP_066299) | 10 ug |
$3,255.00
|
|
LC409203 | MYL6 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC412144 | MYL6 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY409203 | Transient overexpression lysate of myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 2 | 100 ug |
$436.00
|
|
LY412144 | Transient overexpression lysate of myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 1 | 100 ug |
$436.00
|
|
TP300708 | Recombinant protein of human myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP324925 | Recombinant protein of human myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.