ALKBH6 (NM_032878) Human Recombinant Protein

SKU
TP324553
Recombinant protein of human alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224553 representing NM_032878
Red=Cloning site Green=Tags(s)

MAGRGMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQV
FNAPKPKWTQLSGRKLQNWGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIM
PHEDGPLYYPTVSTISLGSHTVLDFYEPRRPEDDDPTEQPRPPPRPTTSLLLEPRSLLVLRGPAYTRLLH
GIAAARVDALDAASSPPNAAACPSARPGACLVRGTRVSLTIRRVPRVLRAGLLLGK

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 29.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_116267
Locus ID 84964
UniProt ID Q3KRA9
Cytogenetics 19q13.12
RefSeq Size 980
RefSeq ORF 798
Synonyms ABH6
Summary Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ALKBH6 (NM_032878) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH321937 ALKBH6 MS Standard C13 and N15-labeled recombinant protein (NP_942567) 10 ug
$3,255.00
PH324553 ALKBH6 MS Standard C13 and N15-labeled recombinant protein (NP_116267) 10 ug
$3,255.00
LC404763 ALKBH6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409909 ALKBH6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404763 Transient overexpression lysate of alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 1 100 ug
$436.00
LY409909 Transient overexpression lysate of alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 2 100 ug
$436.00
TP321937 Recombinant protein of human alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.