ALKBH6 (NM_032878) Human Mass Spec Standard

SKU
PH324553
ALKBH6 MS Standard C13 and N15-labeled recombinant protein (NP_116267)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224553]
Predicted MW 29.1 kDa
Protein Sequence
Protein Sequence
>RC224553 representing NM_032878
Red=Cloning site Green=Tags(s)

MAGRGMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQV
FNAPKPKWTQLSGRKLQNWGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIM
PHEDGPLYYPTVSTISLGSHTVLDFYEPRRPEDDDPTEQPRPPPRPTTSLLLEPRSLLVLRGPAYTRLLH
GIAAARVDALDAASSPPNAAACPSARPGACLVRGTRVSLTIRRVPRVLRAGLLLGK

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116267
RefSeq Size 980
RefSeq ORF 798
Synonyms ABH6
Locus ID 84964
UniProt ID Q3KRA9
Cytogenetics 19q13.12
Summary Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ALKBH6 (NM_032878) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH321937 ALKBH6 MS Standard C13 and N15-labeled recombinant protein (NP_942567) 10 ug
$3,255.00
LC404763 ALKBH6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409909 ALKBH6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404763 Transient overexpression lysate of alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 1 100 ug
$436.00
LY409909 Transient overexpression lysate of alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 2 100 ug
$436.00
TP321937 Recombinant protein of human alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP324553 Recombinant protein of human alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.