STEAP3 (NM_018234) Human Recombinant Protein

SKU
TP324274
Recombinant protein of human STEAP family member 3 (STEAP3), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224274 protein sequence
Red=Cloning site Green=Tags(s)

MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPS
AAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTC
TVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLLP
AWKVPTLLALGLFVCFYAYNFVRDVLQPYVQESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAAL
QLRRGTKYQRFPDWLDHWLQHRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWV
EEEVWRMEIYLSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE
ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHALAEKTSHV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060704
Locus ID 55240
UniProt ID Q658P3
Cytogenetics 2q14.2
RefSeq Size 3938
RefSeq ORF 1464
Synonyms AHMIO2; dudlin-2; dudulin-2; pHyde; STMP3; TSAP6
Summary This gene encodes a multipass membrane protein that functions as an iron transporter. The encoded protein can reduce both iron (Fe3+) and copper (Cu2+) cations. This protein may mediate downstream responses to p53, including promoting apoptosis. Deficiency in this gene can cause anemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]
Protein Families Transmembrane
Protein Pathways p53 signaling pathway
Write Your Own Review
You're reviewing:STEAP3 (NM_018234) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310595 STEAP3 MS Standard C13 and N15-labeled recombinant protein (NP_001008410) 10 ug
$3,255.00
PH324274 STEAP3 MS Standard C13 and N15-labeled recombinant protein (NP_060704) 10 ug
$3,255.00
LC405328 STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413214 STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423432 STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425238 STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405328 Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 1 100 ug
$665.00
LY413214 Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 2 100 ug
$436.00
LY423432 Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 3 100 ug
$436.00
TP310595 Recombinant protein of human STEAP family member 3 (STEAP3), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.