STEAP3 (NM_018234) Human Mass Spec Standard

SKU
PH324274
STEAP3 MS Standard C13 and N15-labeled recombinant protein (NP_060704)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224274]
Predicted MW 54.6 kDa
Protein Sequence
Protein Sequence
>RC224274 protein sequence
Red=Cloning site Green=Tags(s)

MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPS
AAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTC
TVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLLP
AWKVPTLLALGLFVCFYAYNFVRDVLQPYVQESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAAL
QLRRGTKYQRFPDWLDHWLQHRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWV
EEEVWRMEIYLSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE
ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHALAEKTSHV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060704
RefSeq Size 3938
RefSeq ORF 1464
Synonyms AHMIO2; dudlin-2; dudulin-2; pHyde; STMP3; TSAP6
Locus ID 55240
UniProt ID Q658P3
Cytogenetics 2q14.2
Summary This gene encodes a multipass membrane protein that functions as an iron transporter. The encoded protein can reduce both iron (Fe3+) and copper (Cu2+) cations. This protein may mediate downstream responses to p53, including promoting apoptosis. Deficiency in this gene can cause anemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]
Protein Families Transmembrane
Protein Pathways p53 signaling pathway
Write Your Own Review
You're reviewing:STEAP3 (NM_018234) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310595 STEAP3 MS Standard C13 and N15-labeled recombinant protein (NP_001008410) 10 ug
$3,255.00
LC405328 STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413214 STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423432 STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425238 STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405328 Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 1 100 ug
$665.00
LY413214 Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 2 100 ug
$436.00
LY423432 Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 3 100 ug
$436.00
TP310595 Recombinant protein of human STEAP family member 3 (STEAP3), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP324274 Recombinant protein of human STEAP family member 3 (STEAP3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.