OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STEAP3 (NM_018234) Human Mass Spec Standard

Be the first to review this product
SKU
PH324274
STEAP3 MS Standard C13 and N15-labeled recombinant protein (NP_060704)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA372931 STEAP3 rabbit polyclonal antibody
100 ul
$310.00
LY405328 Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "STEAP3 or NM_018234"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224274
Predicted MW 54.6 kDa
Protein Sequence
Protein Sequence
>RC224274 protein sequence
Red=Cloning site Green=Tags(s)

MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPS
AAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTC
TVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLLP
AWKVPTLLALGLFVCFYAYNFVRDVLQPYVQESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAAL
QLRRGTKYQRFPDWLDHWLQHRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWV
EEEVWRMEIYLSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE
ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHALAEKTSHV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060704
RefSeq Size 3938
RefSeq ORF 1464
Synonyms AHMIO2; dudlin-2; dudulin-2; pHyde; STMP3; TSAP6
Locus ID 55240
UniProt ID Q658P3
Cytogenetics 2q14.2
Summary This gene encodes a multipass membrane protein that functions as an iron transporter. The encoded protein can reduce both iron (Fe3+) and copper (Cu2+) cations. This protein may mediate downstream responses to p53, including promoting apoptosis. Deficiency in this gene can cause anemia. Alternative splicing results in multiple transcript variants. provided by RefSeq, Aug 2015
Protein Families Transmembrane
Protein Pathways p53 signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "STEAP3" proteins (9)
SKU Description Size Price
PH310595 STEAP3 MS Standard C13 and N15-labeled recombinant protein (NP_001008410) 10 ug
$3,360.00
LC405328 Lyophilized STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413214 Lyophilized STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423432 Lyophilized STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405328 Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY413214 Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY423432 Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP310595 Recombinant protein of human STEAP family member 3 (STEAP3), transcript variant 3, 20 µg 20 ug
$867.00
TP324274 Recombinant protein of human STEAP family member 3 (STEAP3), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products