OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CADM3 (NM_021189) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP324162
Recombinant protein of human cell adhesion molecule 3 (CADM3), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA349731 Rabbit Polyclonal Anti-CADM3 Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CADM3 or NM_021189"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224162 protein sequence
Red=Cloning site Green=Tags(s)

MGAPAASLLLLLLLFACCWAPGGANLSQDGYWQEQDLELGTLAPLDEAISSTVWSSPDMLASQDSQPWTS
DETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEG
EYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEP
TRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPRE
GQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNV
NDPSPVPSSSSTYHAIIGGIVAFIVFLLLIMLIFLGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGG
QSGGDDKKEYFI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 46.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_067012
Locus ID 57863
UniProt ID Q8N126
Cytogenetics 1q23.2
RefSeq Size 2540
RefSeq ORF 1296
Synonyms BIgR; IGSF4B; Necl-1; NECL1; synCAM3; TSLL1
Summary The protein encoded by this gene is a calcium-independent cell-cell adhesion protein that can form homodimers or heterodimers with other nectin proteins. The encoded protein has both homophilic and heterophilic cell-cell adhesion activity. This gene is reported to be a tumor suppressor gene. provided by RefSeq, Oct 2016
Protein Categories Intracellular Proteins, Membrane Proteins, Nervous system: Neurodegenerative diseases
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs)
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CADM3" proteins (4)
SKU Description Size Price
PH324162 CADM3 MS Standard C13 and N15-labeled recombinant protein (NP_067012) 10 ug
$3,360.00
LC412028 Lyophilized CADM3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412028 Transient overexpression lysate of cell adhesion molecule 3 (CADM3), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP720367 Recombinant protein of human cell adhesion molecule 3 (CADM3), transcript variant 2 10 ug
$220.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products