OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDE9A (NM_001001568) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP324133
Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA356572 PDE9A Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PDE9A or NM_001001568"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224133 representing NM_001001568
Red=Cloning site Green=Tags(s)

MDAFRSTPYKVRPVAIKQLSEREELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVELEGLKVVE
IEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPETIEALRKPTFDVWLWE
PNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKF
SQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPD
GFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWV
DCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESR
DRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA

TRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 54.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001001568
Locus ID 5152
UniProt ID O76083
Cytogenetics 21q22.3
RefSeq Size 1774
RefSeq ORF 1398
Synonyms HSPDE9A2
Summary The protein encoded by this gene catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The encoded protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides. Multiple transcript variants encoding several different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Progesterone-mediated oocyte maturation, Purine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDE9A" proteins (27)
SKU Description Size Price
PH317127 PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001578) 10 ug
$3,360.00
PH324133 PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001568) 10 ug
$3,360.00
PH324417 PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001574) 10 ug
$3,360.00
LC419224 Lyophilized PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424385 Lyophilized PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424386 Lyophilized PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424388 Lyophilized PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424391 Lyophilized PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424392 Lyophilized PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424393 Lyophilized PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424394 Lyophilized PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424395 Lyophilized PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424399 Lyophilized PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424400 Lyophilized PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419224 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY424385 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY424386 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 4 (as WB positive control) 100 ug
$665.00
LY424388 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 6 (as WB positive control) 100 ug
$665.00
LY424391 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 9 (as WB positive control) 100 ug
$665.00
LY424392 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 10 (as WB positive control) 100 ug
$665.00
LY424393 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 11 (as WB positive control) 100 ug
$436.00
LY424394 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 12 (as WB positive control) 100 ug
$665.00
LY424395 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 13 (as WB positive control) 100 ug
$665.00
LY424399 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 17 (as WB positive control) 100 ug
$665.00
LY424400 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 18 (as WB positive control) 100 ug
$665.00
TP317127 Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 13, 20 µg 20 ug
$737.00
TP324417 Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 9, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products