PDE9A (NM_001001568) Human Recombinant Protein
SKU
TP324133
Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 3, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC224133 representing NM_001001568
Red=Cloning site Green=Tags(s) MDAFRSTPYKVRPVAIKQLSEREELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVELEGLKVVE IEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPETIEALRKPTFDVWLWE PNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKF SQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPD GFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWV DCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESR DRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA TRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 54.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001001568 |
Locus ID | 5152 |
UniProt ID | O76083 |
Cytogenetics | 21q22.3 |
RefSeq Size | 1774 |
RefSeq ORF | 1398 |
Synonyms | HSPDE9A2 |
Summary | The protein encoded by this gene catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The encoded protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH317127 | PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001578) | 10 ug |
$3,255.00
|
|
PH324133 | PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001568) | 10 ug |
$3,255.00
|
|
PH324417 | PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001574) | 10 ug |
$3,255.00
|
|
LC419224 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424385 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424386 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424388 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424391 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424392 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424393 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC424394 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424395 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424399 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424400 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY419224 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 1 | 100 ug |
$665.00
|
|
LY424385 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 3 | 100 ug |
$665.00
|
|
LY424386 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 4 | 100 ug |
$665.00
|
|
LY424388 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 6 | 100 ug |
$665.00
|
|
LY424391 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 9 | 100 ug |
$665.00
|
|
LY424392 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 10 | 100 ug |
$665.00
|
|
LY424393 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 11 | 100 ug |
$436.00
|
|
LY424394 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 12 | 100 ug |
$665.00
|
|
LY424395 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 13 | 100 ug |
$665.00
|
|
LY424399 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 17 | 100 ug |
$665.00
|
|
LY424400 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 18 | 100 ug |
$665.00
|
|
TP317127 | Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 13, 20 µg | 20 ug |
$737.00
|
|
TP324417 | Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 9, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.