PDE9A (NM_001001578) Human Recombinant Protein

SKU
TP317127
Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 13, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217127 representing NM_001001578
Red=Cloning site Green=Tags(s)

MGSGSSSYRPKAIYLDIDGRIQKEHDHLPADHRRRHGLHRPHHAREFRTHSVQSETCGHQATLRAFKINE
LKAEVANHLAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPT
YPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFH
NFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLE
NHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTL
LKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLI
PMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDC
A

TRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 57.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001001578
Locus ID 5152
UniProt ID O76083
Cytogenetics 21q22.3
RefSeq Size 1797
RefSeq ORF 1473
Synonyms HSPDE9A2
Summary The protein encoded by this gene catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The encoded protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Progesterone-mediated oocyte maturation, Purine metabolism
Write Your Own Review
You're reviewing:PDE9A (NM_001001578) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH317127 PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001578) 10 ug
$3,255.00
PH324133 PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001568) 10 ug
$3,255.00
PH324417 PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001574) 10 ug
$3,255.00
LC419224 PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424385 PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424386 PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424388 PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424391 PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424392 PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424393 PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424394 PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424395 PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424399 PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424400 PDE9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419224 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 1 100 ug
$665.00
LY424385 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 3 100 ug
$665.00
LY424386 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 4 100 ug
$665.00
LY424388 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 6 100 ug
$665.00
LY424391 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 9 100 ug
$665.00
LY424392 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 10 100 ug
$665.00
LY424393 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 11 100 ug
$436.00
LY424394 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 12 100 ug
$665.00
LY424395 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 13 100 ug
$665.00
LY424399 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 17 100 ug
$665.00
LY424400 Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 18 100 ug
$665.00
TP324133 Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 3, 20 µg 20 ug
$737.00
TP324417 Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 9, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.