beta Casein (CSN2) (NM_001891) Human Recombinant Protein

SKU
TP323777
Recombinant protein of human casein beta (CSN2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>Peptide sequence encoded by RC223777
Blue=ORF Red=Cloning site Green=Tag(s)

MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFV
EPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLEN
LHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPT
HQIYPVTQPLAPVHNPISV

myc-FLAG tag

Recombinant protein using RC223777 also available, TP323777
Tag C-Myc/DDK
Predicted MW 25.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001882
Locus ID 1447
UniProt ID P05814
Cytogenetics 4q13.3
RefSeq Size 1078
RefSeq ORF 678
Synonyms CASB; PDC213
Summary This gene is a member of the beta casein family. There are two types of casein protein, beta (encoded by this gene) and kappa, both of which are secreted in human milk. Beta casein is the principal protein in human milk and the primary source of essential amino acids for a suckling infant. Beta and kappa casein proteins acting together form spherical micelles which bind within them important dietary minerals, such as calcium and phosphorous. In addition, the C-terminal 14 aa of the protein has antimicrobial activity, especially in preterm milk, displaying antibacterial activity against S. aureus and Y. enterocolitica. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2020]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:beta Casein (CSN2) (NM_001891) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH323777 CSN2 MS Standard C13 and N15-labeled recombinant protein (NP_001882) 10 ug
$3,255.00
LC419688 CSN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419688 Transient overexpression lysate of casein beta (CSN2) 100 ug
$436.00
TP721167 Purified recombinant protein of Human casein beta (CSN2) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.