beta Casein (CSN2) (NM_001891) Human Mass Spec Standard

SKU
PH323777
CSN2 MS Standard C13 and N15-labeled recombinant protein (NP_001882)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223777]
Predicted MW 25.4 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC223777
Blue=ORF Red=Cloning site Green=Tag(s)

MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFV
EPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLEN
LHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPT
HQIYPVTQPLAPVHNPISV

myc-FLAG tag

Recombinant protein using RC223777 also available, TP323777
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001882
RefSeq Size 1078
RefSeq ORF 678
Synonyms CASB; PDC213
Locus ID 1447
UniProt ID P05814
Cytogenetics 4q13.3
Summary This gene is a member of the beta casein family. There are two types of casein protein, beta (encoded by this gene) and kappa, both of which are secreted in human milk. Beta casein is the principal protein in human milk and the primary source of essential amino acids for a suckling infant. Beta and kappa casein proteins acting together form spherical micelles which bind within them important dietary minerals, such as calcium and phosphorous. In addition, the C-terminal 14 aa of the protein has antimicrobial activity, especially in preterm milk, displaying antibacterial activity against S. aureus and Y. enterocolitica. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2020]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:beta Casein (CSN2) (NM_001891) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419688 CSN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419688 Transient overexpression lysate of casein beta (CSN2) 100 ug
$436.00
TP323777 Recombinant protein of human casein beta (CSN2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721167 Purified recombinant protein of Human casein beta (CSN2) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.