USP44 (NM_001042403) Human Recombinant Protein

SKU
TP323740
Recombinant protein of human ubiquitin specific peptidase 44 (USP44), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223740 representing NM_001042403
Red=Cloning site Green=Tags(s)

MLAMDTCKHVGQLQLAQDHSSLNPQKWHCVDCNTTESIWACLSCSHVACGRYIEEHALKHFQESSHPVAL
EVNEMYVFCYLCDDYVLNDNATGDLKLLRRTLSAIKSQNYHCTTRSGRFLRSMGTGDDSYFLHDGAQSLL
QSEDQLYTALWHRRRILMGKIFRTWFEQSPIGRKKQEEPFQEKIVVKREVKKRRQELEYQVKAELESMPP
RKSLRLQGLAQSTIIEIVSVQVPAQTPASPAKDKVLSTSENEISQKVSDSSVKRRPIVTPGVTGLRNLGN
TCYMNSVLQVLSHLLIFRQCFLKLDLNQWLAMTASEKTRSCKHPPVTDTVVYQMNECQEKDTGFVCSRQS
SLSSGLSGGASKGRKMELIQPKEPTSQYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYA
QQDAQEFLCELLDKIQRELETTGTSLPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVTCLACDNKSNTIE
PFWDLSLEFPERYQCSGKDIASQPCLVTEMLAKFTETEALEGKIYVCDQCNSKRRRFSSKPVVLTEAQKQ
LMICHLPQVLRLHLKRFRWSGRNNREKIGVHVGFEEILNMEPYCCRETLKSLRPECFIYDLSAVVMHHGK
GFGSGHYTAYCYNSEGGFWVHCNDSKLSMCTMDEVCKAQAYILFYTQRVTENGHSKLLPPELLLGSQHPN
EDADTSSNEILS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 81 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001035862
Locus ID 84101
UniProt ID Q9H0E7
Cytogenetics 12q22
RefSeq Size 3334
RefSeq ORF 2136
Summary The protein encoded by this gene is a protease that functions as a deubiquitinating enzyme. The encoded protein is thought to help regulate the spindle assembly checkpoint by preventing early anaphase onset. This protein specifically deubiquitinates CDC20, which stabilizes the anaphase promoting complex/cyclosome. [provided by RefSeq, Dec 2016]
Protein Families Druggable Genome, Protease
Write Your Own Review
You're reviewing:USP44 (NM_001042403) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH323740 USP44 MS Standard C13 and N15-labeled recombinant protein (NP_001035862) 10 ug
$3,255.00
LC410340 USP44 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420881 USP44 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410340 Transient overexpression lysate of ubiquitin specific peptidase 44 (USP44), transcript variant 1 100 ug
$436.00
LY420881 Transient overexpression lysate of ubiquitin specific peptidase 44 (USP44), transcript variant 2 100 ug
$665.00
TP762014 Purified recombinant protein of Human ubiquitin specific peptidase 44 (USP44), transcript variant 1,Ala420-Ser712, with N-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.