OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

USP44 (NM_001042403) Human Mass Spec Standard

Be the first to review this product
SKU
PH323740
USP44 MS Standard C13 and N15-labeled recombinant protein (NP_001035862)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA801913 USP44 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1) 100 ul
$447.00
LY410340 Transient overexpression lysate of ubiquitin specific peptidase 44 (USP44), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "USP44 or NM_001042403"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223740
Predicted MW 81 kDa
Protein Sequence
Protein Sequence
>RC223740 representing NM_001042403
Red=Cloning site Green=Tags(s)

MLAMDTCKHVGQLQLAQDHSSLNPQKWHCVDCNTTESIWACLSCSHVACGRYIEEHALKHFQESSHPVAL
EVNEMYVFCYLCDDYVLNDNATGDLKLLRRTLSAIKSQNYHCTTRSGRFLRSMGTGDDSYFLHDGAQSLL
QSEDQLYTALWHRRRILMGKIFRTWFEQSPIGRKKQEEPFQEKIVVKREVKKRRQELEYQVKAELESMPP
RKSLRLQGLAQSTIIEIVSVQVPAQTPASPAKDKVLSTSENEISQKVSDSSVKRRPIVTPGVTGLRNLGN
TCYMNSVLQVLSHLLIFRQCFLKLDLNQWLAMTASEKTRSCKHPPVTDTVVYQMNECQEKDTGFVCSRQS
SLSSGLSGGASKGRKMELIQPKEPTSQYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYA
QQDAQEFLCELLDKIQRELETTGTSLPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVTCLACDNKSNTIE
PFWDLSLEFPERYQCSGKDIASQPCLVTEMLAKFTETEALEGKIYVCDQCNSKRRRFSSKPVVLTEAQKQ
LMICHLPQVLRLHLKRFRWSGRNNREKIGVHVGFEEILNMEPYCCRETLKSLRPECFIYDLSAVVMHHGK
GFGSGHYTAYCYNSEGGFWVHCNDSKLSMCTMDEVCKAQAYILFYTQRVTENGHSKLLPPELLLGSQHPN
EDADTSSNEILS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035862
RefSeq Size 3334
RefSeq ORF 2136
Locus ID 84101
UniProt ID Q9H0E7
Cytogenetics 12q22
Summary The protein encoded by this gene is a protease that functions as a deubiquitinating enzyme. The encoded protein is thought to help regulate the spindle assembly checkpoint by preventing early anaphase onset. This protein specifically deubiquitinates CDC20, which stabilizes the anaphase promoting complex/cyclosome. provided by RefSeq, Dec 2016
Protein Families Druggable Genome, Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "USP44" proteins (6)
SKU Description Size Price
LC410340 Lyophilized USP44 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420881 Lyophilized USP44 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410340 Transient overexpression lysate of ubiquitin specific peptidase 44 (USP44), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420881 Transient overexpression lysate of ubiquitin specific peptidase 44 (USP44), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP323740 Recombinant protein of human ubiquitin specific peptidase 44 (USP44), transcript variant 2, 20 µg 20 ug
$867.00
TP762014 Purified recombinant protein of Human ubiquitin specific peptidase 44 (USP44), transcript variant 1,Ala420-Ser712, with N-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products