Adropin (ENHO) (NM_198573) Human Recombinant Protein

SKU TP323456

Recombinant protein of human energy homeostasis associated (ENHO), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC223456 representing NM_198573; Red=Cloning site Green=Tags(s); ; MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEG; SYLLQP; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_940975
• Locus ID: 375704
• UniProt ID: Q6UWT2
• Cytogenetics: 9p13.3
• RefSeq Size: 1093
• RefSeq ORF: 228
• Synonyms: C9orf165; UNQ470
• Summary: Involved in the regulation of glucose homeostasis and lipid metabolism.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane