Adropin (ENHO) (NM_198573) Human Tagged ORF Clone

SKU
RC223456
ENHO (Myc-DDK-tagged)-Human energy homeostasis associated (ENHO)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Adropin
Synonyms C9orf165; UNQ470
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223456 representing NM_198573
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGCAGCCATCTCCCAGGGGGCCCTCATCGCCATCGTCTGCAACGGTCTCGTGGGCTTCTTGCTGC
TGCTGCTCTGGGTCATCCTCTGCTGGGCCTGCCATTCTCGCTCTGCCGACGTTGACTCTCTCTCTGAATC
CAGTCCCAACTCCAGCCCTGGCCCCTGTCCTGAGAAGGCCCCACCACCCCAGAAGCCCAGCCATGAAGGC
AGCTACCTGCTGCAGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223456 representing NM_198573
Red=Cloning site Green=Tags(s)

MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEG
SYLLQP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_198573
ORF Size 228 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_198573.3
RefSeq Size 1093 bp
RefSeq ORF 231 bp
Locus ID 375704
UniProt ID Q6UWT2
Cytogenetics 9p13.3
Protein Families Transmembrane
MW 7.7 kDa
Summary Involved in the regulation of glucose homeostasis and lipid metabolism.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Adropin (ENHO) (NM_198573) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223456L1 Lenti ORF clone of Human energy homeostasis associated (ENHO), Myc-DDK-tagged 10 ug
$450.00
RC223456L2 Lenti ORF clone of Human energy homeostasis associated (ENHO), mGFP tagged 10 ug
$450.00
RC223456L3 Lenti ORF clone of Human energy homeostasis associated (ENHO), Myc-DDK-tagged 10 ug
$450.00
RC223456L4 Lenti ORF clone of Human energy homeostasis associated (ENHO), mGFP tagged 10 ug
$450.00
RG223456 ENHO (tGFP-tagged) - Human energy homeostasis associated (ENHO) 10 ug
$489.00
SC107852 ENHO (untagged)-Human energy homeostasis associated (ENHO) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.