CCK4 (PTK7) (NM_152880) Human Recombinant Protein

SKU
TP323416
Recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223416 representing NM_152880
Red=Cloning site Green=Tags(s)

MGAARGSPARPRRLPLLSVLLLPLLGGTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVYWLLDGA
PVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFNIKWIEAGPVVLKHPASEAEI
QPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSAFGQAC
SSQNFTLSIADESFARVVLAPQDVVVARYEEAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATV
FANGSLLLTQVRPRNAGIYRCIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLP
EPSVWWEHAGVRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVATVPSWLKKPQD
SQLEEGKPGYLDCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINSVEVYDGTWYRCMSSTPAGSI
EAQARVQVLDGSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPER
TTVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGRYTCIAGNSC
NIKHTEAPLYVVDKPVPEESEGPGSPPPYKMIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPE
GEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEV
FLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDL
GDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALG
LSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQ
AGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDSKP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 110.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_690619
Locus ID 5754
UniProt ID Q13308
Cytogenetics 6p21.1
RefSeq Size 4129
RefSeq ORF 3090
Synonyms CCK-4; CCK4
Summary This gene encodes a member of the receptor protein tyrosine kinase family of proteins that transduce extracellular signals across the cell membrane. The encoded protein lacks detectable catalytic tyrosine kinase activity, is involved in the Wnt signaling pathway and plays a role in multiple cellular processes including polarity and adhesion. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Write Your Own Review
You're reviewing:CCK4 (PTK7) (NM_152880) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH320322 PTK7 MS Standard C13 and N15-labeled recombinant protein (NP_690620) 10 ug
$3,255.00
PH323416 PTK7 MS Standard C13 and N15-labeled recombinant protein (NP_690619) 10 ug
$3,255.00
LC407251 PTK7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407251 Transient overexpression lysate of PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3 100 ug
$665.00
TP320322 Recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3, 20 µg 20 ug
$867.00
TP700163 Purified recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-1, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$867.00
TP700164 Purified recombinant protein of human protein tyrosine kinase 7 (PTK7), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$867.00
TP700165 Purified recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$867.00
TP710169 Purified recombinant protein of Human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-1, residues 31-704aa, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.