CCK4 (PTK7) (NM_152881) Human Mass Spec Standard

SKU
PH320322
PTK7 MS Standard C13 and N15-labeled recombinant protein (NP_690620)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220322]
Predicted MW 100.4 kDa
Protein Sequence
Protein Sequence
>RC220322 representing NM_152881
Red=Cloning site Green=Tags(s)

MGAARGSPARPRRLPLLSVLLLPLLGGTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVYWLLDGA
PVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFNIKWIEAGPVVLKHPASEAEI
QPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSAFGQAC
SSQNFTLSIADESFARVVLAPQDVVVARYEEAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATV
FANGSLLLTQVRPRNAGIYRCIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLP
EPSVWWEHAGVRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVANGSSLPEWVTD
NAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPERTTVYQGHTALLQCEAQGDPK
PLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGRYTCIAGNSCNIKHTEAPLYVVDKPVPEES
EGPGSPPPYKMIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPS
AEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVK
SLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQ
PLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPL
RWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLM
QRCWALSPKDRPSFSEIASALGDSTVDSKP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_690620
RefSeq Size 3859
RefSeq ORF 2820
Synonyms CCK-4; CCK4
Locus ID 5754
UniProt ID Q13308
Cytogenetics 6p21.1
Summary This gene encodes a member of the receptor protein tyrosine kinase family of proteins that transduce extracellular signals across the cell membrane. The encoded protein lacks detectable catalytic tyrosine kinase activity, is involved in the Wnt signaling pathway and plays a role in multiple cellular processes including polarity and adhesion. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Write Your Own Review
You're reviewing:CCK4 (PTK7) (NM_152881) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH323416 PTK7 MS Standard C13 and N15-labeled recombinant protein (NP_690619) 10 ug
$3,255.00
LC407251 PTK7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407251 Transient overexpression lysate of PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3 100 ug
$665.00
TP320322 Recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3, 20 µg 20 ug
$867.00
TP323416 Recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-2, 20 µg 20 ug
$867.00
TP700163 Purified recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-1, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$867.00
TP700164 Purified recombinant protein of human protein tyrosine kinase 7 (PTK7), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$867.00
TP700165 Purified recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$867.00
TP710169 Purified recombinant protein of Human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-1, residues 31-704aa, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.