CCK4 (PTK7) (NM_152881) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC220322] |
Predicted MW | 100.4 kDa |
Protein Sequence |
Protein Sequence
>RC220322 representing NM_152881
Red=Cloning site Green=Tags(s) MGAARGSPARPRRLPLLSVLLLPLLGGTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVYWLLDGA PVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFNIKWIEAGPVVLKHPASEAEI QPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSAFGQAC SSQNFTLSIADESFARVVLAPQDVVVARYEEAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATV FANGSLLLTQVRPRNAGIYRCIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLP EPSVWWEHAGVRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVANGSSLPEWVTD NAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPERTTVYQGHTALLQCEAQGDPK PLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGRYTCIAGNSCNIKHTEAPLYVVDKPVPEES EGPGSPPPYKMIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPS AEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVK SLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQ PLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPL RWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLM QRCWALSPKDRPSFSEIASALGDSTVDSKP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_690620 |
RefSeq Size | 3859 |
RefSeq ORF | 2820 |
Synonyms | CCK-4; CCK4 |
Locus ID | 5754 |
UniProt ID | Q13308 |
Cytogenetics | 6p21.1 |
Summary | This gene encodes a member of the receptor protein tyrosine kinase family of proteins that transduce extracellular signals across the cell membrane. The encoded protein lacks detectable catalytic tyrosine kinase activity, is involved in the Wnt signaling pathway and plays a role in multiple cellular processes including polarity and adhesion. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH323416 | PTK7 MS Standard C13 and N15-labeled recombinant protein (NP_690619) | 10 ug |
$3,255.00
|
|
LC407251 | PTK7 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY407251 | Transient overexpression lysate of PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3 | 100 ug |
$665.00
|
|
TP320322 | Recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3, 20 µg | 20 ug |
$867.00
|
|
TP323416 | Recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-2, 20 µg | 20 ug |
$867.00
|
|
TP700163 | Purified recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-1, with C-terminal DDK/His tag, expressed in human cells, 20 µg | 20 ug |
$867.00
|
|
TP700164 | Purified recombinant protein of human protein tyrosine kinase 7 (PTK7), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg | 20 ug |
$867.00
|
|
TP700165 | Purified recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3, with C-terminal DDK/His tag, expressed in human cells, 20 µg | 20 ug |
$867.00
|
|
TP710169 | Purified recombinant protein of Human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-1, residues 31-704aa, with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.