NOXO1 (NM_172168) Human Recombinant Protein

SKU
TP323385
Purified recombinant protein of Homo sapiens NADPH oxidase organizer 1 (NOXO1), transcript variant c, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223385 representing NM_172168
Red=Cloning site Green=Tags(s)

MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKKTLKETFPVEAGLLRRSDRVL
PKLLGQASLDAPLLGRVGRTSRGLARLQLLETYSRRLLATAERVARSPTITGFFAPQPLDLEPALPPGSR
VILPTPEEQPLSRAAGRLSIHSLEAQSLRCLQPFCTQDTRDRPFQAQAQESLDVLLRHPSGWWLVENEDR
QTAWFPAPYLEEAAPGQGREGGPSLGSSGPQFCASRAYESSRADELSVPAGARVRVLETSDRGWWLCRYG
DRAGLLPAVLLRPEGLGALLSGTGFRGGDDPAGEARGFPEPSQATAPPPTVPTRPSPGAIQSRCCTVTRR
ALERRPRRQGRPRGCVDSVPHPTTEQ

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 41.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_751908
Locus ID 124056
UniProt ID Q8NFA2
Cytogenetics 16p13.3
RefSeq Size 1147
RefSeq ORF 1128
Synonyms P41NOX; P41NOXA; P41NOXB; P41NOXC; SH3PXD5; SNX28
Summary This gene encodes an NADPH oxidase (NOX) organizer, which positively regulates NOX1 and NOX3. The protein contains a PX domain and two SH3 domains. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2012]
Write Your Own Review
You're reviewing:NOXO1 (NM_172168) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH314973 NOXO1 MS Standard C13 and N15-labeled recombinant protein (NP_751907) 10 ug
$3,255.00
PH323385 NOXO1 MS Standard C13 and N15-labeled recombinant protein (NP_751908) 10 ug
$3,255.00
LC403398 NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406778 NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406779 NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430349 NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403398 Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant a 100 ug
$436.00
LY406778 Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant b 100 ug
$436.00
LY406779 Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant c 100 ug
$436.00
TP314973 Recombinant protein of human NADPH oxidase organizer 1 (NOXO1), transcript variant b, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761645 Purified recombinant protein of Human NADPH oxidase organizer 1 (NOXO1), transcript variant a, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.