NOXO1 (NM_172167) Human Mass Spec Standard

SKU
PH314973
NOXO1 MS Standard C13 and N15-labeled recombinant protein (NP_751907)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214973]
Predicted MW 40.6 kDa
Protein Sequence
Protein Sequence
>RC214973 representing NM_172167
Red=Cloning site Green=Tags(s)

MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKKTLKETFPVEAGLLRRSDRVL
PKLLDAPLLGRVGRTSRGLARLQLLETYSRRLLATAERVARSPTITGFFAPQPLDLEPALPPGSRVILPT
PEEQPLSRAAGRLSIHSLEAQSLRCLQPFCTQDTRDRPFQAQAQESLDVLLRHPSGWWLVENEDRQTAWF
PAPYLEEAAPGQGREGGPSLGSSGPQFCASRAYESSRADELSVPAGARVRVLETSDRGWWLCRYGDRAGL
LPAVLLRPEGLGALLSGTGFRGGDDPAGEARGFPEPSQATAPPPTVPTRPSPGAIQSRCCTVTRRALERR
PRRQGRPRGCVDSVPHPTTEQ

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_751907
RefSeq Size 1132
RefSeq ORF 1113
Synonyms P41NOX; P41NOXA; P41NOXB; P41NOXC; SH3PXD5; SNX28
Locus ID 124056
UniProt ID Q8NFA2
Cytogenetics 16p13.3
Summary This gene encodes an NADPH oxidase (NOX) organizer, which positively regulates NOX1 and NOX3. The protein contains a PX domain and two SH3 domains. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2012]
Write Your Own Review
You're reviewing:NOXO1 (NM_172167) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH323385 NOXO1 MS Standard C13 and N15-labeled recombinant protein (NP_751908) 10 ug
$3,255.00
LC403398 NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406778 NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406779 NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430349 NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403398 Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant a 100 ug
$436.00
LY406778 Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant b 100 ug
$436.00
LY406779 Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant c 100 ug
$436.00
TP314973 Recombinant protein of human NADPH oxidase organizer 1 (NOXO1), transcript variant b, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323385 Purified recombinant protein of Homo sapiens NADPH oxidase organizer 1 (NOXO1), transcript variant c, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761645 Purified recombinant protein of Human NADPH oxidase organizer 1 (NOXO1), transcript variant a, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.