ALDH1A2 (NM_003888) Human Recombinant Protein

SKU
TP323250
Recombinant protein of human aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223250 representing NM_003888
Red=Cloning site Green=Tags(s)

MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQ
EADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDL
QGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIK
PAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNL
KRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVG
SPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG
PVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSG
NGREMGEFGLREYSEVKTVTVKIPQKNS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003879
Locus ID 8854
UniProt ID O94788
Cytogenetics 15q21.3
RefSeq Size 3398
RefSeq ORF 1554
Synonyms RALDH(II); RALDH2; RALDH2-T
Summary This protein belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Four transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, May 2011]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Retinol metabolism
Write Your Own Review
You're reviewing:ALDH1A2 (NM_003888) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305342 ALDH1A2 MS Standard C13 and N15-labeled recombinant protein (NP_733797) 10 ug
$3,255.00
PH323250 ALDH1A2 MS Standard C13 and N15-labeled recombinant protein (NP_003879) 10 ug
$3,255.00
LC403525 ALDH1A2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406883 ALDH1A2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418372 ALDH1A2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430305 ALDH1A2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403525 Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 2 100 ug
$436.00
LY406883 Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 3 100 ug
$665.00
LY418372 Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 1 100 ug
$665.00
TP305342 Recombinant protein of human aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.