MATK (NM_139355) Human Recombinant Protein

SKU
TP323161
Recombinant protein of human megakaryocyte-associated tyrosine kinase (MATK), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223161 representing NM_139355
Red=Cloning site Green=Tags(s)

MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHTRPKPGELAFR
KGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPE
DGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRP
KRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVM
TKMQHENLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVH
RDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSY
GRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPAS
VSGQDADGSTSPRSQEP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_647612
Locus ID 4145
UniProt ID P42679
Cytogenetics 19p13.3
RefSeq Size 2183
RefSeq ORF 1521
Synonyms CHK; CTK; HHYLTK; HYL; HYLTK; Lsk
Summary The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase, Stem cell - Pluripotency
Write Your Own Review
You're reviewing:MATK (NM_139355) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300454 MATK MS Standard C13 and N15-labeled recombinant protein (NP_647611) 10 ug
$3,255.00
PH323161 MATK MS Standard C13 and N15-labeled recombinant protein (NP_647612) 10 ug
$3,255.00
LC408299 MATK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408300 MATK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419363 MATK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408299 Transient overexpression lysate of megakaryocyte-associated tyrosine kinase (MATK), transcript variant 3 100 ug
$436.00
LY408300 Transient overexpression lysate of megakaryocyte-associated tyrosine kinase (MATK), transcript variant 1 100 ug
$665.00
LY419363 Transient overexpression lysate of megakaryocyte-associated tyrosine kinase (MATK), transcript variant 2 100 ug
$665.00
TP300454 Recombinant protein of human megakaryocyte-associated tyrosine kinase (MATK), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.