MATK (NM_139354) Human Mass Spec Standard

SKU
PH300454
MATK MS Standard C13 and N15-labeled recombinant protein (NP_647611)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200454]
Predicted MW 56.5 kDa
Protein Sequence
Protein Sequence
>RC200454 protein sequence
Red=Cloning site Green=Tags(s)

MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHTRPKPGELAFR
KGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPE
DGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRP
KRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVM
TKMQHENLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVH
RDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSY
GRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPAS
VSGQDADGSTSPRSQEP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_647611
RefSeq Size 1940
RefSeq ORF 1521
Synonyms CHK; CTK; HHYLTK; HYL; HYLTK; Lsk
Locus ID 4145
UniProt ID P42679
Cytogenetics 19p13.3
Summary The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase, Stem cell - Pluripotency
Write Your Own Review
You're reviewing:MATK (NM_139354) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH323161 MATK MS Standard C13 and N15-labeled recombinant protein (NP_647612) 10 ug
$3,255.00
LC408299 MATK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408300 MATK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419363 MATK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408299 Transient overexpression lysate of megakaryocyte-associated tyrosine kinase (MATK), transcript variant 3 100 ug
$436.00
LY408300 Transient overexpression lysate of megakaryocyte-associated tyrosine kinase (MATK), transcript variant 1 100 ug
$665.00
LY419363 Transient overexpression lysate of megakaryocyte-associated tyrosine kinase (MATK), transcript variant 2 100 ug
$665.00
TP300454 Recombinant protein of human megakaryocyte-associated tyrosine kinase (MATK), transcript variant 3, 20 µg 20 ug
$737.00
TP323161 Recombinant protein of human megakaryocyte-associated tyrosine kinase (MATK), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.