CTNND1 (NM_001085458) Human Recombinant Protein
SKU
TP322771
Recombinant protein of human catenin (cadherin-associated protein), delta 1 (CTNND1), transcript variant 1, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC222771 representing NM_001085458
Red=Cloning site Green=Tags(s) MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFV GDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETT VKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPP DGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPY GLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASL DSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHP KKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIV DHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIF IVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFS RGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGR YIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNF SEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLE KEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNER GDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 108 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001078927 |
Locus ID | 1500 |
UniProt ID | O60716 |
Cytogenetics | 11q12.1 |
RefSeq Size | 6363 |
RefSeq ORF | 2904 |
Synonyms | BCDS2; CAS; CTNND; p120; p120(CAS); p120(CTN); P120CAS; P120CTN |
Summary | This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene. [provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Leukocyte transendothelial migration |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH322771 | CTNND1 MS Standard C13 and N15-labeled recombinant protein (NP_001078927) | 10 ug |
$3,255.00
|
|
LC421307 | CTNND1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC421310 | CTNND1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC421316 | CTNND1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY421307 | Transient overexpression lysate of catenin (cadherin-associated protein), delta 1 (CTNND1), transcript variant 1 | 100 ug |
$665.00
|
|
LY421310 | Transient overexpression lysate of catenin (cadherin-associated protein), delta 1 (CTNND1), transcript variant 5 | 100 ug |
$665.00
|
|
LY421316 | Transient overexpression lysate of catenin (cadherin-associated protein), delta 1 (CTNND1), transcript variant 11 | 100 ug |
$665.00
|
|
TP762349 | Purified recombinant protein of Human catenin (cadherin-associated protein), delta 1 (CTNND1), transcript variant 1, Leu759-Asp901, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$249.00
|
|
TP762394 | Purified recombinant protein of Human catenin (cadherin-associated protein), delta 1 (CTNND1), transcript variant 1, Gly58-Pro369, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$249.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.