CTNND1 (NM_001085458) Human Mass Spec Standard

SKU
PH322771
CTNND1 MS Standard C13 and N15-labeled recombinant protein (NP_001078927)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222771]
Predicted MW 108.2 kDa
Protein Sequence
Protein Sequence
>RC222771 representing NM_001085458
Red=Cloning site Green=Tags(s)

MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFV
GDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETT
VKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPP
DGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPY
GLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASL
DSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHP
KKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIV
DHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIF
IVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFS
RGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGR
YIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNF
SEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLE
KEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNER
GDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001078927
RefSeq Size 6363
RefSeq ORF 2904
Synonyms BCDS2; CAS; CTNND; p120; p120(CAS); p120(CTN); P120CAS; P120CTN
Locus ID 1500
UniProt ID O60716
Cytogenetics 11q12.1
Summary This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene. [provided by RefSeq, Dec 2010]
Protein Families Druggable Genome
Protein Pathways Adherens junction, Leukocyte transendothelial migration
Write Your Own Review
You're reviewing:CTNND1 (NM_001085458) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421307 CTNND1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421310 CTNND1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421316 CTNND1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421307 Transient overexpression lysate of catenin (cadherin-associated protein), delta 1 (CTNND1), transcript variant 1 100 ug
$665.00
LY421310 Transient overexpression lysate of catenin (cadherin-associated protein), delta 1 (CTNND1), transcript variant 5 100 ug
$665.00
LY421316 Transient overexpression lysate of catenin (cadherin-associated protein), delta 1 (CTNND1), transcript variant 11 100 ug
$665.00
TP322771 Recombinant protein of human catenin (cadherin-associated protein), delta 1 (CTNND1), transcript variant 1, 20 µg 20 ug
$737.00
TP762349 Purified recombinant protein of Human catenin (cadherin-associated protein), delta 1 (CTNND1), transcript variant 1, Leu759-Asp901, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00
TP762394 Purified recombinant protein of Human catenin (cadherin-associated protein), delta 1 (CTNND1), transcript variant 1, Gly58-Pro369, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.