CELF2 (NM_001083591) Human Recombinant Protein
SKU
TP322724
Purified recombinant protein of Homo sapiens CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 4, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC222724 representing NM_001083591
Red=Cloning site Green=Tags(s) MNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRK AALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRIL RGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNT ATWGNLTGLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQLQNLATLAAAAAAAQTSATSTNANP LSTTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVGLNNINALAGTINSMAALNGGLGAT GLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGPEGANLFIYHLPQEFGDQDIL QMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001077060 |
Locus ID | 10659 |
UniProt ID | O95319 |
Cytogenetics | 10p14 |
RefSeq Size | 8053 |
RefSeq ORF | 1464 |
Synonyms | BRUNOL3; CELF-2; CUG-BP2; CUGBP2; ETR-3; ETR3; NAPOR |
Summary | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH322724 | CELF2 MS Standard C13 and N15-labeled recombinant protein (NP_001077060) | 10 ug |
$3,255.00
|
|
PH324548 | CELF2 MS Standard C13 and N15-labeled recombinant protein (NP_006552) | 10 ug |
$3,255.00
|
|
LC416560 | CELF2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC421224 | CELF2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC422579 | CELF2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY416560 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 2 | 100 ug |
$665.00
|
|
LY421224 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 4 | 100 ug |
$665.00
|
|
LY422579 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 3 | 100 ug |
$665.00
|
|
TP324548 | Recombinant protein of human CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.