CELF2 (NM_001083591) Human Mass Spec Standard

SKU
PH322724
CELF2 MS Standard C13 and N15-labeled recombinant protein (NP_001077060)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222724]
Predicted MW 51.9 kDa
Protein Sequence
Protein Sequence
>RC222724 representing NM_001083591
Red=Cloning site Green=Tags(s)

MNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRK
AALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRIL
RGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNT
ATWGNLTGLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQLQNLATLAAAAAAAQTSATSTNANP
LSTTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVGLNNINALAGTINSMAALNGGLGAT
GLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGPEGANLFIYHLPQEFGDQDIL
QMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001077060
RefSeq Size 8053
RefSeq ORF 1464
Synonyms BRUNOL3; CELF-2; CUG-BP2; CUGBP2; ETR-3; ETR3; NAPOR
Locus ID 10659
UniProt ID O95319
Cytogenetics 10p14
Summary Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CELF2 (NM_001083591) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH324548 CELF2 MS Standard C13 and N15-labeled recombinant protein (NP_006552) 10 ug
$3,255.00
LC416560 CELF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421224 CELF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422579 CELF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416560 Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 2 100 ug
$665.00
LY421224 Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 4 100 ug
$665.00
LY422579 Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 3 100 ug
$665.00
TP322724 Purified recombinant protein of Homo sapiens CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 4, 20 µg 20 ug
$737.00
TP324548 Recombinant protein of human CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.