TTC39C (NM_153211) Human Recombinant Protein

SKU
TP322003
Recombinant protein of human tetratricopeptide repeat domain 39C (TTC39C), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222003 protein sequence
Red=Cloning site Green=Tags(s)

MSFGASFVSFLNAMMTFEEEKMQLACDDLKTTEKLCESEEAGVIETIKNKIKKNVDVRKSAPSMVDRLQR
QIIIADCQVYLAVLSFVKQELSAYIKGGWILRKAWKIYNKCYLDINALQELYQKKLTEESLTSDAANDNH
IVAEGVSEESLNRLKGAVSFGYGLFHLCISMVPPNLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLA
TLALLWYHTVVRPFFALDGSDNKAGLDEAKEILLKKEAAYPNSSLFMFFKGRIQRLECQINSALTSFHTA
LELAVDQREIQHVCLYEIGWCSMIELNFKDAFDSFERLKNESRWSQCYYAYLTAVCQGATGDVDGAQIVF
KEVQKLFKRKNNQIEQFSVKKAERFRKQTPTKALCVLASIEVLYLWKALPNCSFPNLQRMSQACHEVDDS
SVVGLKYLLLGAIHKCLGNSEDAVQYFQRAVKDELCRQNNLYVQPYACYELGCLLLDKPETVGRGRALLL
QAKEDFSGYDFENRLHVRIHAALASLRELVPQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 59 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_694943
Locus ID 125488
UniProt ID Q8N584
Cytogenetics 18q11.2
RefSeq Size 4900
RefSeq ORF 1566
Synonyms C18orf17; HsT2697
Write Your Own Review
You're reviewing:TTC39C (NM_153211) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH322003 TTC39C MS Standard C13 and N15-labeled recombinant protein (NP_694943) 10 ug
$3,255.00
PH327432 TTC39C MS Standard C13 and N15-labeled recombinant protein (NP_001129465) 10 ug
$3,255.00
LC407140 TTC39C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427747 TTC39C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407140 Transient overexpression lysate of tetratricopeptide repeat domain 39C (TTC39C), transcript variant 2 100 ug
$665.00
LY427747 Transient overexpression lysate of tetratricopeptide repeat domain 39C (TTC39C), transcript variant 1 100 ug
$436.00
TP327432 Recombinant protein of human tetratricopeptide repeat domain 39C (TTC39C), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.