TTC39C (NM_001135993) Human Mass Spec Standard

SKU
PH327432
TTC39C MS Standard C13 and N15-labeled recombinant protein (NP_001129465)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227432]
Predicted MW 65.7 kDa
Protein Sequence
Protein Sequence
>RC227432 representing NM_001135993
Red=Cloning site Green=Tags(s)

MAGSEQQRPRRRDDGDSDAAAAAAAPLQDAELALAGINMLLNNGFRESDQLFKQYRNHSPLMSFGASFVS
FLNAMMTFEEEKMQLACDDLKTTEKLCESEEAGVIETIKNKIKKNVDVRKSAPSMVDRLQRQIIIADCQV
YLAVLSFVKQELSAYIKGGWILRKAWKIYNKCYLDINALQELYQKKLTEESLTSDAANDNHIVAEGVSEE
SLNRLKGAVSFGYGLFHLCISMVPPNLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHT
VVRPFFALDGSDNKAGLDEAKEILLKKEAAYPNSSLFMFFKGRIQRLECQINSALTSFHTALELAVDQRE
IQHVCLYEIGWCSMIELNFKDAFDSFERLKNESRWSQCYYAYLTAVCQGATGDVDGAQIVFKEVQKLFKR
KNNQIEQFSVKKAERFRKQTPTKALCVLASIEVLYLWKALPNCSFPNLQRMSQACHEVDDSSVVGLKYLL
LGAIHKCLGNSEDAVQYFQRAVKDELCRQNNLYVQPYACYELGCLLLDKPETVGRGRALLLQAKEDFSGY
DFENRLHVRIHAALASLRELVPQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129465
RefSeq ORF 1749
Synonyms C18orf17; HsT2697
Locus ID 125488
UniProt ID Q8N584
Cytogenetics 18q11.2
Write Your Own Review
You're reviewing:TTC39C (NM_001135993) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH322003 TTC39C MS Standard C13 and N15-labeled recombinant protein (NP_694943) 10 ug
$3,255.00
LC407140 TTC39C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427747 TTC39C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407140 Transient overexpression lysate of tetratricopeptide repeat domain 39C (TTC39C), transcript variant 2 100 ug
$665.00
LY427747 Transient overexpression lysate of tetratricopeptide repeat domain 39C (TTC39C), transcript variant 1 100 ug
$436.00
TP322003 Recombinant protein of human tetratricopeptide repeat domain 39C (TTC39C), transcript variant 2, 20 µg 20 ug
$867.00
TP327432 Recombinant protein of human tetratricopeptide repeat domain 39C (TTC39C), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.