beta Arrestin 1 (ARRB1) (NM_020251) Human Recombinant Protein

SKU
TP321737
Purified recombinant protein of Homo sapiens arrestin, beta 1 (ARRB1), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221737 representing NM_020251
Red=Cloning site Green=Tags(s)

MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDV
LGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKAC
GVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYH
GEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAN
NREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKE
EPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 46.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_064647
Locus ID 408
UniProt ID P49407
Cytogenetics 11q13.4
RefSeq Size 2180
RefSeq ORF 1230
Synonyms ARB1; ARR1
Summary Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described. [provided by RefSeq, Jan 2011]
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway, Endocytosis, MAPK signaling pathway
Write Your Own Review
You're reviewing:beta Arrestin 1 (ARRB1) (NM_020251) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH321737 ARRB1 MS Standard C13 and N15-labeled recombinant protein (NP_064647) 10 ug
$3,255.00
LC412547 ARRB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418298 ARRB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429613 ARRB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412547 Transient overexpression lysate of arrestin, beta 1 (ARRB1), transcript variant 2 100 ug
$436.00
LY418298 Transient overexpression lysate of arrestin, beta 1 (ARRB1), transcript variant 1 100 ug
$436.00
TP720083 Recombinant protein of human arrestin, beta 1 (ARRB1), transcript variant 1 10 ug
$265.00
TP762120 Purified recombinant protein of Human arrestin, beta 1 (ARRB1), transcript variant 1,full length, with N-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.