Kallikrein 6 (KLK6) (NM_001012965) Human Recombinant Protein
SKU
TP321436
Purified recombinant protein of Homo sapiens kallikrein-related peptidase 6 (KLK6), transcript variant C, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC221436 representing NM_001012965
Red=Cloning site Green=Tags(s) MKKLMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQV FLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHI LGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGL VSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQAK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001012983 |
Locus ID | 5653 |
UniProt ID | Q92876 |
Cytogenetics | 19q13.41 |
RefSeq Size | 1495 |
RefSeq ORF | 732 |
Synonyms | Bssp; hK6; Klk7; PRSS9; PRSS18; SP59 |
Summary | This gene encodes a member of the kallikrein subfamily of the peptidase S1 family of serine proteases. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The encoded preproprotein is proteolytically processed to generate the mature protease. Expression of this protease is regulated by steroid hormones and may be elevated in multiple human cancers and in serum from psoriasis patients. The encoded protease may participate in the cleavage of amyloid precursor protein and alpha-synuclein, thus implicating this protease in Alzheimer's and Parkinson's disease, respectively. This gene is located in a gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH302146 | KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_001012982) | 10 ug |
$3,255.00
|
|
PH318647 | KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_002765) | 10 ug |
$3,255.00
|
|
PH321436 | KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_001012983) | 10 ug |
$3,255.00
|
|
LC400982 | KLK6 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422842 | KLK6 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422843 | KLK6 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400982 | Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant A | 100 ug |
$436.00
|
|
LY422842 | Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant B | 100 ug |
$436.00
|
|
LY422843 | Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant C | 100 ug |
$436.00
|
|
TP302146 | Purified recombinant protein of Homo sapiens kallikrein-related peptidase 6 (KLK6), transcript variant B, 20 µg | 20 ug |
$737.00
|
|
TP318647 | Recombinant protein of human kallikrein-related peptidase 6 (KLK6), transcript variant A, 20 µg | 20 ug |
$737.00
|
|
TP720315 | Recombinant protein of human kallikrein-related peptidase 6 (KLK6), transcript variant B | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.