Kallikrein 6 (KLK6) (NM_001012965) Human Mass Spec Standard

SKU
PH321436
KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_001012983)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221436]
Predicted MW 26.86 kDa
Protein Sequence
Protein Sequence
>RC221436 representing NM_001012965
Red=Cloning site Green=Tags(s)

MKKLMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQV
FLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHI
LGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGL
VSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQAK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001012983
RefSeq Size 1495
RefSeq ORF 732
Synonyms Bssp; hK6; Klk7; PRSS9; PRSS18; SP59
Locus ID 5653
UniProt ID Q92876
Cytogenetics 19q13.41
Summary This gene encodes a member of the kallikrein subfamily of the peptidase S1 family of serine proteases. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The encoded preproprotein is proteolytically processed to generate the mature protease. Expression of this protease is regulated by steroid hormones and may be elevated in multiple human cancers and in serum from psoriasis patients. The encoded protease may participate in the cleavage of amyloid precursor protein and alpha-synuclein, thus implicating this protease in Alzheimer's and Parkinson's disease, respectively. This gene is located in a gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016]
Protein Families Druggable Genome, Protease, Secreted Protein
Write Your Own Review
You're reviewing:Kallikrein 6 (KLK6) (NM_001012965) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302146 KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_001012982) 10 ug
$3,255.00
PH318647 KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_002765) 10 ug
$3,255.00
LC400982 KLK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422842 KLK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422843 KLK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400982 Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant A 100 ug
$436.00
LY422842 Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant B 100 ug
$436.00
LY422843 Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant C 100 ug
$436.00
TP302146 Purified recombinant protein of Homo sapiens kallikrein-related peptidase 6 (KLK6), transcript variant B, 20 µg 20 ug
$737.00
TP318647 Recombinant protein of human kallikrein-related peptidase 6 (KLK6), transcript variant A, 20 µg 20 ug
$737.00
TP321436 Purified recombinant protein of Homo sapiens kallikrein-related peptidase 6 (KLK6), transcript variant C, 20 µg 20 ug
$737.00
TP720315 Recombinant protein of human kallikrein-related peptidase 6 (KLK6), transcript variant B 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.