LIPF (NM_004190) Human Recombinant Protein

SKU
TP321225
Recombinant protein of human lipase, gastric (LIPF), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221225 representing NM_004190
Red=Cloning site Green=Tags(s)

MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKN
SGNTGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAF
SFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSL
INKLRFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLS
HNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQD
VGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 43.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004181
Locus ID 8513
UniProt ID P07098
Cytogenetics 10q23.31
RefSeq Size 1365
RefSeq ORF 1194
Synonyms GL; HGL; HLAL
Summary This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Glycerolipid metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:LIPF (NM_004190) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH321225 LIPF MS Standard C13 and N15-labeled recombinant protein (NP_004181) 10 ug
$3,255.00
LC401348 LIPF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434185 LIPF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434194 LIPF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434213 LIPF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401348 Transient overexpression lysate of lipase, gastric (LIPF) 100 ug
$436.00
LY434185 Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 3 100 ug
$436.00
LY434194 Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 4 100 ug
$436.00
LY434213 Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 1 100 ug
$436.00
TP721035 Purified recombinant protein of Human lipase, gastric (LIPF), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.