LIPF (NM_004190) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC221225] |
Predicted MW | 45.24 kDa |
Protein Sequence |
Protein Sequence
>RC221225 representing NM_004190
Red=Cloning site Green=Tags(s) MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKN SGNTGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAF SFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSL INKLRFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLS HNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQD VGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_004181 |
RefSeq Size | 1365 |
RefSeq ORF | 1194 |
Synonyms | GL; HGL; HLAL |
Locus ID | 8513 |
UniProt ID | P07098 |
Cytogenetics | 10q23.31 |
Summary | This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Glycerolipid metabolism, Metabolic pathways |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC401348 | LIPF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC434185 | LIPF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC434194 | LIPF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC434213 | LIPF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401348 | Transient overexpression lysate of lipase, gastric (LIPF) | 100 ug |
$436.00
|
|
LY434185 | Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 3 | 100 ug |
$436.00
|
|
LY434194 | Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 4 | 100 ug |
$436.00
|
|
LY434213 | Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 1 | 100 ug |
$436.00
|
|
TP321225 | Recombinant protein of human lipase, gastric (LIPF), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP721035 | Purified recombinant protein of Human lipase, gastric (LIPF), transcript variant 2 | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.