LIPF (NM_004190) Human Mass Spec Standard

SKU
PH321225
LIPF MS Standard C13 and N15-labeled recombinant protein (NP_004181)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221225]
Predicted MW 45.24 kDa
Protein Sequence
Protein Sequence
>RC221225 representing NM_004190
Red=Cloning site Green=Tags(s)

MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKN
SGNTGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAF
SFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSL
INKLRFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLS
HNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQD
VGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004181
RefSeq Size 1365
RefSeq ORF 1194
Synonyms GL; HGL; HLAL
Locus ID 8513
UniProt ID P07098
Cytogenetics 10q23.31
Summary This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Glycerolipid metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:LIPF (NM_004190) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401348 LIPF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434185 LIPF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434194 LIPF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434213 LIPF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401348 Transient overexpression lysate of lipase, gastric (LIPF) 100 ug
$436.00
LY434185 Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 3 100 ug
$436.00
LY434194 Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 4 100 ug
$436.00
LY434213 Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 1 100 ug
$436.00
TP321225 Recombinant protein of human lipase, gastric (LIPF), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721035 Purified recombinant protein of Human lipase, gastric (LIPF), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.