Calneuron 1 (CALN1) (NM_001017440) Human Recombinant Protein

SKU
TP321065
Purified recombinant protein of Homo sapiens calneuron 1 (CALN1), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221065 representing NM_001017440
Red=Cloning site Green=Tags(s)

MPFHHVTAGLLYKGNYLNRSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGY
MPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHIL
YHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFAMAFIISVMLIAA
NQILRSGME

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001017440
Locus ID 83698
UniProt ID Q9BXU9
Cytogenetics 7q11.22
RefSeq Size 5802
RefSeq ORF 657
Synonyms CABP8
Summary This gene encodes a protein with high similarity to the calcium-binding proteins of the calmodulin family. The encoded protein contains two EF-hand domains and potential calcium-binding sites. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:Calneuron 1 (CALN1) (NM_001017440) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH321065 CALN1 MS Standard C13 and N15-labeled recombinant protein (NP_001017440) 10 ug
$3,255.00
LC410502 CALN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422736 CALN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410502 Transient overexpression lysate of calneuron 1 (CALN1), transcript variant 1 100 ug
$436.00
LY422736 Transient overexpression lysate of calneuron 1 (CALN1), transcript variant 2 100 ug
$436.00
TP761145 Purified recombinant protein of Human calneuron 1 (CALN1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.