Calneuron 1 (CALN1) (NM_001017440) Human Mass Spec Standard

SKU
PH321065
CALN1 MS Standard C13 and N15-labeled recombinant protein (NP_001017440)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221065]
Predicted MW 24.7 kDa
Protein Sequence
Protein Sequence
>RC221065 representing NM_001017440
Red=Cloning site Green=Tags(s)

MPFHHVTAGLLYKGNYLNRSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGY
MPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHIL
YHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFAMAFIISVMLIAA
NQILRSGME

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001017440
RefSeq Size 5802
RefSeq ORF 657
Synonyms CABP8
Locus ID 83698
UniProt ID Q9BXU9
Cytogenetics 7q11.22
Summary This gene encodes a protein with high similarity to the calcium-binding proteins of the calmodulin family. The encoded protein contains two EF-hand domains and potential calcium-binding sites. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:Calneuron 1 (CALN1) (NM_001017440) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410502 CALN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422736 CALN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410502 Transient overexpression lysate of calneuron 1 (CALN1), transcript variant 1 100 ug
$436.00
LY422736 Transient overexpression lysate of calneuron 1 (CALN1), transcript variant 2 100 ug
$436.00
TP321065 Purified recombinant protein of Homo sapiens calneuron 1 (CALN1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761145 Purified recombinant protein of Human calneuron 1 (CALN1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.