KATNAL1 (NM_001014380) Human Recombinant Protein

SKU
TP320944
Recombinant protein of human katanin p60 subunit A-like 1 (KATNAL1), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220944 protein sequence
Red=Cloning site Green=Tags(s)

MNLAEICDNAKKGREYALLGNYDSSMVYYQGVMQQIQRHCQSVRDPAIKGKWQQVRQELLEEYEQVKSIV
STLESFKIDKPPDFPVSCQDEPFRDPAVWPPPVPAEHRAPPQIRRPNREVRPLRKEMAGVGARGPVGRAH
PISKSEKPSTSRDKDYRARGRDDKGRKNMQDGASDGEMPKFDGAGYDKDLVEALERDIVSRNPSIHWDDI
ADLEEAKKLLREAVVLPMWMPDFFKGIRRPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSK
YRGESEKLVRLLFEMARFYAPTTIFIDEIDSICSRRGTSDEHEASRRVKSELLIQMDGVGGALENDDPSK
MVMVLAATNFPWDIDEALRRRLEKRIYIPLPTAKGRAELLKINLREVELDPDIQLEDIAEKIEGYSGADI
TNVCRDASLMAMRRRINGLSPEEIRALSKEELQMPVTKGDFELALKKIAKSVSAADLEKYEKWMVEFGSA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001014402
Locus ID 84056
UniProt ID Q9BW62
Cytogenetics 13q12.3
RefSeq Size 7512
RefSeq ORF 1470
Summary Regulates microtubule dynamics in Sertoli cells, a process that is essential for spermiogenesis and male fertility. Severs microtubules in an ATP-dependent manner, promoting rapid reorganization of cellular microtubule arrays (By similarity). Has microtubule-severing activity in vitro (PubMed:26929214).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:KATNAL1 (NM_001014380) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300828 KATNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_115492) 10 ug
$3,255.00
PH320944 KATNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_001014402) 10 ug
$3,255.00
LC403145 KATNAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423055 KATNAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403145 Transient overexpression lysate of katanin p60 subunit A-like 1 (KATNAL1), transcript variant 1 100 ug
$436.00
LY423055 Transient overexpression lysate of katanin p60 subunit A-like 1 (KATNAL1), transcript variant 2 100 ug
$665.00
TP300828 Recombinant protein of human katanin p60 subunit A-like 1 (KATNAL1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.