KATNAL1 (NM_032116) Human Mass Spec Standard

SKU
PH300828
KATNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_115492)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200828]
Predicted MW 55.4 kDa
Protein Sequence
Protein Sequence
>RC200828 protein sequence
Red=Cloning site Green=Tags(s)

MNLAEICDNAKKGREYALLGNYDSSMVYYQGVMQQIQRHCQSVRDPAIKGKWQQVRQELLEEYEQVKSIV
STLESFKIDKPPDFPVSCQDEPFRDPAVWPPPVPAEHRAPPQIRRPNREVRPLRKEMAGVGARGPVGRAH
PISKSEKPSTSRDKDYRARGRDDKGRKNMQDGASDGEMPKFDGAGYDKDLVEALERDIVSRNPSIHWDDI
ADLEEAKKLLREAVVLPMWMPDFFKGIRRPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSK
YRGESEKLVRLLFEMARFYAPTTIFIDEIDSICSRRGTSDEHEASRRVKSELLIQMDGVGGALENDDPSK
MVMVLAATNFPWDIDEALRRRLEKRIYIPLPTAKGRAELLKINLREVELDPDIQLEDIAEKIEGYSGADI
TNVCRDASLMAMRRRINGLSPEEIRALSKEELQMPVTKGDFELALKKIAKSVSAADLEKYEKWMVEFGSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115492
RefSeq Size 7554
RefSeq ORF 1470
Locus ID 84056
UniProt ID Q9BW62
Cytogenetics 13q12.3
Summary Regulates microtubule dynamics in Sertoli cells, a process that is essential for spermiogenesis and male fertility. Severs microtubules in an ATP-dependent manner, promoting rapid reorganization of cellular microtubule arrays (By similarity). Has microtubule-severing activity in vitro (PubMed:26929214).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:KATNAL1 (NM_032116) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH320944 KATNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_001014402) 10 ug
$3,255.00
LC403145 KATNAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423055 KATNAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403145 Transient overexpression lysate of katanin p60 subunit A-like 1 (KATNAL1), transcript variant 1 100 ug
$436.00
LY423055 Transient overexpression lysate of katanin p60 subunit A-like 1 (KATNAL1), transcript variant 2 100 ug
$665.00
TP300828 Recombinant protein of human katanin p60 subunit A-like 1 (KATNAL1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320944 Recombinant protein of human katanin p60 subunit A-like 1 (KATNAL1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.