OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KATNAL1 (NM_032116) Human Mass Spec Standard

Be the first to review this product
SKU
PH300828
KATNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_115492)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502344 KATNAL1 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7) 100 ul
$447.00
LY403145 Transient overexpression lysate of katanin p60 subunit A-like 1 (KATNAL1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "KATNAL1 or NM_032116"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200828
Predicted MW 55.4 kDa
Protein Sequence
Protein Sequence
>RC200828 protein sequence
Red=Cloning site Green=Tags(s)

MNLAEICDNAKKGREYALLGNYDSSMVYYQGVMQQIQRHCQSVRDPAIKGKWQQVRQELLEEYEQVKSIV
STLESFKIDKPPDFPVSCQDEPFRDPAVWPPPVPAEHRAPPQIRRPNREVRPLRKEMAGVGARGPVGRAH
PISKSEKPSTSRDKDYRARGRDDKGRKNMQDGASDGEMPKFDGAGYDKDLVEALERDIVSRNPSIHWDDI
ADLEEAKKLLREAVVLPMWMPDFFKGIRRPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSK
YRGESEKLVRLLFEMARFYAPTTIFIDEIDSICSRRGTSDEHEASRRVKSELLIQMDGVGGALENDDPSK
MVMVLAATNFPWDIDEALRRRLEKRIYIPLPTAKGRAELLKINLREVELDPDIQLEDIAEKIEGYSGADI
TNVCRDASLMAMRRRINGLSPEEIRALSKEELQMPVTKGDFELALKKIAKSVSAADLEKYEKWMVEFGSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115492
RefSeq Size 7554
RefSeq ORF 1470
Locus ID 84056
UniProt ID Q9BW62
Cytogenetics 13q12.3
Summary Regulates microtubule dynamics in Sertoli cells, a process that is essential for spermiogenesis and male fertility. Severs microtubules in an ATP-dependent manner, promoting rapid reorganization of cellular microtubule arrays (By similarity). Has microtubule-severing activity in vitro (PubMed:26929214).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KATNAL1" proteins (7)
SKU Description Size Price
PH320944 KATNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_001014402) 10 ug
$3,360.00
LC403145 Lyophilized KATNAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423055 Lyophilized KATNAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403145 Transient overexpression lysate of katanin p60 subunit A-like 1 (KATNAL1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423055 Transient overexpression lysate of katanin p60 subunit A-like 1 (KATNAL1), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP300828 Recombinant protein of human katanin p60 subunit A-like 1 (KATNAL1), transcript variant 1, 20 µg 20 ug
$867.00
TP320944 Recombinant protein of human katanin p60 subunit A-like 1 (KATNAL1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products