NRP2 (NM_201266) Human Recombinant Protein

SKU
TP320920
Recombinant protein of human neuropilin 2 (NRP2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220920 representing NM_201266
Red=Cloning site Green=Tags(s)

MTFYSPAVMNYSVPGSTSNLDGGPVRLSTSPNVLWPTSGHLSPLATHCQSSLLYAEPQKSPWCEARSLEH
TLPVNRETLKRKLSGSSCASPVTSPNAKRDAHFCPVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYIC
PATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRIVRRQRSSSEQVHCLSKAKRNGGHAPRV
KELLLSTLSPEQLVLTLLEAEPPNVLVSRPSMPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLL
DQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHK
EYLCVKAMILLNSSMYPLASANQEAESSRKLTHLLNAVTDALVWVIAKSGISSQQQSVRLANLLMLLSHV
RHISNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGYKSSISGSECSSTEDSKNKESSQNLQSQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 102.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_957718
Locus ID 8828
UniProt ID O60462
Cytogenetics 2q33.3
RefSeq Size 6671
RefSeq ORF 2793
Synonyms NP2; NPN2; PRO2714; VEGF165R2
Summary This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:NRP2 (NM_201266) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310928 NRP2 MS Standard C13 and N15-labeled recombinant protein (NP_957719) 10 ug
$3,255.00
PH320920 NRP2 MS Standard C13 and N15-labeled recombinant protein (NP_957718) 10 ug
$3,255.00
LC401275 NRP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403706 NRP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404506 NRP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430844 NRP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401275 Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 2 100 ug
$665.00
LY403706 Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 1 100 ug
$665.00
LY404506 Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 5 100 ug
$436.00
LY430844 Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 6 100 ug
$436.00
TP310928 Recombinant protein of human neuropilin 2 (NRP2), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.