NRP2 (NM_201266) Human Mass Spec Standard

SKU
PH320920
NRP2 MS Standard C13 and N15-labeled recombinant protein (NP_957718)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220920]
Predicted MW 102.3 kDa
Protein Sequence
Protein Sequence
>RC220920 representing NM_201266
Red=Cloning site Green=Tags(s)

MTFYSPAVMNYSVPGSTSNLDGGPVRLSTSPNVLWPTSGHLSPLATHCQSSLLYAEPQKSPWCEARSLEH
TLPVNRETLKRKLSGSSCASPVTSPNAKRDAHFCPVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYIC
PATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRIVRRQRSSSEQVHCLSKAKRNGGHAPRV
KELLLSTLSPEQLVLTLLEAEPPNVLVSRPSMPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLL
DQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHK
EYLCVKAMILLNSSMYPLASANQEAESSRKLTHLLNAVTDALVWVIAKSGISSQQQSVRLANLLMLLSHV
RHISNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGYKSSISGSECSSTEDSKNKESSQNLQSQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_957718
RefSeq Size 6671
RefSeq ORF 2793
Synonyms NP2; NPN2; PRO2714; VEGF165R2
Locus ID 8828
UniProt ID O60462
Cytogenetics 2q33.3
Summary This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:NRP2 (NM_201266) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310928 NRP2 MS Standard C13 and N15-labeled recombinant protein (NP_957719) 10 ug
$3,255.00
LC401275 NRP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403706 NRP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404506 NRP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430844 NRP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401275 Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 2 100 ug
$665.00
LY403706 Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 1 100 ug
$665.00
LY404506 Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 5 100 ug
$436.00
LY430844 Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 6 100 ug
$436.00
TP310928 Recombinant protein of human neuropilin 2 (NRP2), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320920 Recombinant protein of human neuropilin 2 (NRP2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.