Esa1 (FLOT2) (NM_004475) Human Recombinant Protein

SKU
TP320884
Purified recombinant protein of Homo sapiens flotillin 2 (FLOT2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220884 representing NM_004475
Red=Cloning site Green=Tags(s)

MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVT
GVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAP
DVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADT
KIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDK
ELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQK
YGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLI
KKATGVQV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 46.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004466
Locus ID 2319
UniProt ID Q14254
Cytogenetics 17q11.2
RefSeq Size 2659
RefSeq ORF 1284
Synonyms ECS-1; ECS1; ESA; ESA1; M17S1
Summary Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Insulin signaling pathway
Write Your Own Review
You're reviewing:Esa1 (FLOT2) (NM_004475) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH320884 FLOT2 MS Standard C13 and N15-labeled recombinant protein (NP_004466) 10 ug
$3,255.00
LC401425 FLOT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401425 Transient overexpression lysate of flotillin 2 (FLOT2) 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.