Esa1 (FLOT2) (NM_004475) Human Mass Spec Standard

SKU
PH320884
FLOT2 MS Standard C13 and N15-labeled recombinant protein (NP_004466)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220884]
Predicted MW 46.9 kDa
Protein Sequence
Protein Sequence
>RC220884 representing NM_004475
Red=Cloning site Green=Tags(s)

MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVT
GVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAP
DVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADT
KIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDK
ELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQK
YGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLI
KKATGVQV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004466
RefSeq Size 2659
RefSeq ORF 1284
Synonyms ECS-1; ECS1; ESA; ESA1; M17S1
Locus ID 2319
UniProt ID Q14254
Cytogenetics 17q11.2
Summary Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Insulin signaling pathway
Write Your Own Review
You're reviewing:Esa1 (FLOT2) (NM_004475) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401425 FLOT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401425 Transient overexpression lysate of flotillin 2 (FLOT2) 100 ug
$665.00
TP320884 Purified recombinant protein of Homo sapiens flotillin 2 (FLOT2), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.