Galectin 8 (LGALS8) (NM_006499) Human Recombinant Protein
SKU
TP320102
Purified recombinant protein of Homo sapiens lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC220102 representing NM_006499
Red=Cloning site Green=Tags(s) MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRF KRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGI YGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLPSNRGGDISKIAPRTVYTKSKDSTVNH TLTCTKIPPMNYVSKRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKA FVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD IHLLEVRSW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_006490 |
Locus ID | 3964 |
UniProt ID | O00214 |
Cytogenetics | 1q43 |
RefSeq Size | 2996 |
RefSeq ORF | 1077 |
Synonyms | Gal-8; PCTA-1; PCTA1; Po66-CBP |
Summary | This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303752 | LGALS8 MS Standard C13 and N15-labeled recombinant protein (NP_963838) | 10 ug |
$3,255.00
|
|
PH320102 | LGALS8 MS Standard C13 and N15-labeled recombinant protein (NP_006490) | 10 ug |
$3,255.00
|
|
PH320163 | LGALS8 MS Standard C13 and N15-labeled recombinant protein (NP_963837) | 10 ug |
$3,255.00
|
|
LC404450 | LGALS8 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC404451 | LGALS8 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC404452 | LGALS8 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC416600 | LGALS8 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY404450 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 2 | 100 ug |
$436.00
|
|
LY404451 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 3 | 100 ug |
$436.00
|
|
LY404452 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 4 | 100 ug |
$436.00
|
|
LY416600 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 1 | 100 ug |
$436.00
|
|
TP303752 | Recombinant protein of human lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP320163 | Recombinant protein of human lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.